PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000887107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 328aa    MW: 37145.4 Da    PI: 7.0645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000887107genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l +++k++G g+W+  +++ g++R++k+c++rw++yl
    MDP0000887107 14 RGAWTAHEDKVLTQYIKLHGEGRWRNLPKKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding53.17.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
    MDP0000887107  67 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.972961IPR017930Myb domain
SuperFamilySSF466893.08E-2812108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-231568IPR009057Homeodomain-like
CDDcd001673.80E-101661No hitNo description
PROSITE profilePS5129425.4262116IPR017930Myb domain
SMARTSM007175.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2469115IPR009057Homeodomain-like
CDDcd001673.57E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRSPCCAKE GLNRGAWTAH EDKVLTQYIK LHGEGRWRNL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVPDRQ  120
QQRSASNLKH HKNGEPNSKK AKSMDMASPS SLVYRTKAVK CTQVFINPQP HKVLLGHDHQ  180
HCTEETNTVL MFDGKPAAMD DDHINRTLSF SSFSNINADQ ENSTSDFLVD FDMNEISIAS  240
LLNSDFPEIN RDYLNHNNSD TITSHFVDET AQFFSEEMLQ HWNNGGSDDG DNQVQVQPNL  300
ALNFHSFTSF LGSDHQGEEW LGVGESS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.224500.0fruit| leaf
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008337875.10.0PREDICTED: transcription factor MYB12 isoform X2
TrEMBLM5WG391e-162M5WG39_PRUPE; Uncharacterized protein
STRINGGLYMA13G16890.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-65MYB family protein